PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID cra_locus_7838_iso_1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Gentianales; Apocynaceae; Rauvolfioideae; Vinceae; Catharanthinae; Catharanthus
Family SBP
Protein Properties Length: 417aa    MW: 46334.6 Da    PI: 7.2506
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
cra_locus_7838_iso_1genomeMPGR-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP130.94.5e-41162239178
                                          --SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT------- CS
                                  SBP   1 lCqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrr 74 
                                          +CqvegC++ l +ak+yhrrhkvCe+hskap+v+v g+eqrfCqqCsrfh++sefDe+krsCrrrLa+hnerrr
  cra_locus_7838_iso_1_len_1380_ver_3 162 RCQVEGCNVALINAKDYHRRHKVCEMHSKAPKVVVLGVEQRFCQQCSRFHAVSEFDESKRSCRRRLAGHNERRR 235
                                          6************************************************************************* PP

                                          S--- CS
                                  SBP  75 kkqa 78 
                                          k+++
  cra_locus_7838_iso_1_len_1380_ver_3 236 KSSH 239
                                          *975 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:4.10.1100.102.1E-34159224IPR004333Transcription factor, SBP-box
PROSITE profilePS5114132.71160237IPR004333Transcription factor, SBP-box
SuperFamilySSF1036121.96E-38161241IPR004333Transcription factor, SBP-box
PfamPF031101.8E-32163236IPR004333Transcription factor, SBP-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 417 aa     Download sequence    Send to blast
XGWNIWDNSS SSSAGEERAV SNSRFDWGNN QFNPHNSFTT SSSTSSAAAA DNEENAAAVH  60
ALMLAHHHDR GLYGGVGRGN YFPDPHLMCL KLGKRHYFGE SIIANADNPL GVDRQGVSAA  120
AAVAVNYNSM TKKETGYYEV GGGGCEGGSA EVTVASVTAI PRCQVEGCNV ALINAKDYHR  180
RHKVCEMHSK APKVVVLGVE QRFCQQCSRF HAVSEFDESK RSCRRRLAGH NERRRKSSHS  240
QQQQQEHSAT IRNQSQVNNS EVMTYSGRHP YLPSSSNNNS SWNISSSPDL PTRCSAALRE  300
LIAENRAAIL ARQLILDKDW RWHPAHHPSE DHHDHLNGGR GECESNSFLN LNYQHQHQQM  360
ATTGSHENWE RMGEADSQVT LDLMQAPNAA FGFLSVRGKS KETDQECPEL WSSFWRS
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ul4_A2e-30158236684squamosa promoter binding protein-like 4
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010661347.11e-100PREDICTED: squamosa promoter-binding-like protein 7 isoform X1
RefseqXP_010661348.11e-100PREDICTED: squamosa promoter-binding-like protein 7 isoform X2
TrEMBLA0A068UPD11e-130A0A068UPD1_COFCA; Uncharacterized protein
STRINGVIT_15s0021g02290.t013e-99(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA134081417